Myllyn Paras mansikka-raparperilevypiirakka 14palaa/1,25kg kypsä, pakaste
6417700169113
Oy Lantmännen Unibake Ab
Sales unit:
ST
Sales amount:
3
ST
VAT %:
14.0%
Delivery & availability
Product type:
Order product
If you want to buy order products in smaller quantities, please contact your C&C manager or sales manager
Juicy strawberry-rhubarb-filled sheet pie. There are three sheets in the sale lot, each disc is already cut into 21 pieces.
Ingredients
WHEAT flour, sugar, vegetable oil (rapeseed, palm), strawberry 14% (EU), rhubarb 14% (EU), water, glucose syrup, WHEAT starch, whole EGG powder, EGG WHITE powder, raising agents (E450, E500), stabilizer (E466), color (E160a), flavor, flour treatment agent (E300), emulsifier (E471), salt, acidity regulator (E330), vitamin A, vitamin D. May contain traces of almond, milk.
Origin of product
Country of manufacture | Finland  |
Genetically modified code | Free from  |
Origin of ingredients
Strawberry |
826_ingredientContentPercentage : 14 
Rearing : European Union  |
Rhubarb |
826_ingredientContentPercentage : 14 
Rearing : European Union  |
Nutritional properties
Contains allergen(s) |
Eggs and their derivatives in the product 
Wheat and its derivatives  Cereals containing gluten and its derivatives  |
May contain allergen(s) |
Almond and almond products 
Milk and its derivatives  Tree nuts and its derivatives  |
Free From | Lactose  |
Energy content (kJ) | 1504  kJ |
Energy content (kcal) | 360  kcal |
fat, total | 19  g |
fatty acids, total saturated | 2.5  g |
Carbohydrates | 43  g |
fibre | 1.7  g |
Protein | 4.2  g |
Salt | 0.6  g |
Carbohydrates of which lact. | 0  g |
Additive Name |
E160a Carotenes 
E450 Diphosphates  E466 Carboxy methyl cellulose, Sodium carboxy methyl cellulose  E500 Sodium Carbonates  E300 Ascorbic acid  E471 Mono- and diglycerides of fatty acids  E330 Citric acid  |
Brand Name | Myllyn Paras |
Packaging label | Made in Finland Flag with Key |
Storage type | Frozen goods |
Packaging type code | Bag |
Supplier identification code | 6911 |
Handling Instructions Code Reference |
Frozen product
Foodstuffs |
Preparation instructions (Fin) | Sulata 2 h huoneenlämmössä tai yön yli kylmiössä. |
Preparation instructions (Swe) | Tina 2 h i rumstemperatur eller över natten i kyl. |
Consumer storage instructions (fin) | Pakaste. Säilytettävä -18 °C:ssa tai kylmemmässä. Ei saa jäädyttää uudelleen sulatuksen jälkeen. |
Consumer storage instructions (swe) | Djupfryst. Förvaras i -18 °C eller kallare. Får inte frysas efter upptining. |
Consumer storage instructions (eng) | Frozen. Store at -18°C or colder. Do not refreeze after thawing. |
Minimum storage handling temperature | -25 °C |
Maximum storage handling temperature | -18 °C |
Opened item lifespan (days) | 5 pv |
Get inspired
Product concept renewal
Uudistimme tuotekonseptimme yhdessä asiakkaiden kanssa. Tavoitteenamme on helpottaa yrittäjien arkea ja auttaa valitsemaan sopivat tuotteet entistä helpommin.
Read more
Edessä huikea yhteistyövuosi 2023
Wihuri Metro-tukun palveluvalikoimaan kuuluvan Demo Kitchenin päätehtävänä on auttaa Metro-tukun asiakasyrityksiä ravintolaliiketoiminnan kehittämisessä
Read more
Huolehditaan hävikistä
Metro-tukun pikatukuissa hävikistä huolehditaan yhteistyökumppanien kanssa.
Read more
Mutkaton menu helposti
Houkutteleva menu syntyy Wihuri Metro-tukun oman merkin ja oman maahantuonnin valikoimasta
Read more